Name: TROP-2, Rat (246a.a, HEK293, His)
Brand: QuantiMol
SKU: QM-0205583-01
Price: 79.85 GBP
Availability: InStock

Product Details

Description
The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
494343 (Gene_ID) Q6P9Z6 (Q25-G270) (Accession)
Smiles
QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205583-01	5 µgQM-0205583-01 £79.85/ea	£0.00	Quantity	£79.85/ea	£0.00

10 µgQM-0205583-02	10 µgQM-0205583-02 £119.50/ea	£0.00	Quantity	£119.50/ea	£0.00

50 µgQM-0205583-03	50 µgQM-0205583-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0205583-04	100 µgQM-0205583-04 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

500 µgQM-0205583-05	500 µgQM-0205583-05 £1,323.32/ea	£0.00	Quantity	£1,323.32/ea	£0.00

1 mgQM-0205583-06	1 mgQM-0205583-06 £2,097.28/ea	£0.00	Quantity	£2,097.28/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TROP-2, Rat (246a.a, HEK293, His)

TROP-2, Rat (246a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.