Skip to product information
1 of 1

TROP-2, Rhesus macaque (HEK293, His)

TROP-2, Rhesus macaque (HEK293, His)

Size

SKU:QM-0180870-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    716334 (Gene_ID) XP_001114599.1 (H27-R272) (Accession)

  • Smiles

    HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180870-01
10 µgQM-0180870-01
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0180870-02
50 µgQM-0180870-02
£249.26/ea
£0.00
£249.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TROP-2, Rhesus macaque (HEK293, His)

TROP-2, Rhesus macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.