Troponin C/TNNC1, Human (N-His)

Name: Troponin C/TNNC1, Human (N-His)
Brand: QuantiMol
SKU: QM-0169256-01
Price: 116.13 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0169256-01

£116.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (N-His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
7134 (Gene_ID) P63316 (M1-E161) (Accession)
Smiles
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Purity
92
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169256-01	5 µgQM-0169256-01 £116.13/ea	£0.00	Quantity	£116.13/ea	£0.00

10 µgQM-0169256-02	10 µgQM-0169256-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

50 µgQM-0169256-03	50 µgQM-0169256-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

100 µgQM-0169256-04	100 µgQM-0169256-04 £840.97/ea	£0.00	Quantity	£840.97/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Troponin C/TNNC1, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.