Skip to product information
1 of 1

TRP1, Human (HEK293, His)

TRP1, Human (HEK293, His)

Size

SKU:QM-0205329-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu (2+) ions. This activity is inhibited by Zn (2+) . TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    7306 (Gene_ID) P17643 (Q25-R471) (Accession)

  • Smiles

    QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205329-01
5 µgQM-0205329-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0205329-02
10 µgQM-0205329-02
£133.00/ea
£0.00
£133.00/ea £0.00
50 µgQM-0205329-03
50 µgQM-0205329-03
£370.76/ea
£0.00
£370.76/ea £0.00
100 µgQM-0205329-04
100 µgQM-0205329-04
£591.89/ea
£0.00
£591.89/ea £0.00
500 µgQM-0205329-05
500 µgQM-0205329-05
£1,566.32/ea
£0.00
£1,566.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TRP1, Human (HEK293, His)

TRP1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.