TSLP, Mouse (HEK293, Fc)

Name: TSLP, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0077605-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0077605-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)
Smiles
YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0077605-01	2 µgQM-0077605-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0077605-02	10 µgQM-0077605-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0077605-03	50 µgQM-0077605-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

100 µgQM-0077605-04	100 µgQM-0077605-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0077605-05	500 µgQM-0077605-05 £979.48/ea	£0.00	Quantity	£979.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

TSLP, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.