Skip to product information
1 of 1

TSPAN31, Human (HEK293, Fc)

TSPAN31, Human (HEK293, Fc)

Size

SKU:QM-0205685-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TSPAN31 is a member of the tetraspanin protein family, which has four hydrophobic domains. TSPAN31 mediates signal transduction events and plays a role in the regulation of cell development, activation, growth, and movement. TSPAN31 is also associated with tumorigenesis and osteosarcoma. TSPAN31 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN31 protein, expressed by HEK293 , with N-mFc labeled tag.

  • Molecular Formula

    6302 (Gene_ID) Q12999 (C94-K173) (Accession)

  • Smiles

    CSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205685-01
5 µgQM-0205685-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0205685-02
10 µgQM-0205685-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0205685-03
50 µgQM-0205685-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205685-04
100 µgQM-0205685-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0205685-05
500 µgQM-0205685-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00
1 mgQM-0205685-06
1 mgQM-0205685-06
£1,837.27/ea
£0.00
£1,837.27/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TSPAN31, Human (HEK293, Fc)

TSPAN31, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.