Skip to product information
1 of 1

Tubulin cofactor A, Human (Tag Free)

Tubulin cofactor A, Human (Tag Free)

Size

SKU:QM-0205411-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E) . Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.

  • Molecular Formula

    6902 (Gene_ID) O75347 (M1-A108) (Accession)

  • Smiles

    MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205411-01
5 µgQM-0205411-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0205411-02
10 µgQM-0205411-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0205411-03
50 µgQM-0205411-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0205411-04
100 µgQM-0205411-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0205411-05
500 µgQM-0205411-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00
1 mgQM-0205411-06
1 mgQM-0205411-06
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Tubulin cofactor A, Human (Tag Free)

Tubulin cofactor A, Human (Tag Free) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.