Tubulin cofactor A, Human (Tag Free)
Tubulin cofactor A, Human (Tag Free)
SKU:QM-0205411-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E) . Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free.
-
Molecular Formula
6902 (Gene_ID) O75347 (M1-A108) (Accession)
-
Smiles
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0055073-01 (10Z,13Z) -Nonadeca-10,13-dienoic acid [CAS 29204-20-4]
- QM-0055025-01 20-O-Acetylcamptothecin [CAS 7688-64-4]
- QM-0055022 3'-Azidomethyi-dGTP [CAS 1048022-06-5]
- QM-0054666 DGTPαS [CAS 82337-56-2]
- QM-0054664 DATPαS [CAS 64145-28-4]
- QM-0054663 3’-O-Acetyl-dATP (sodium)
- QM-0054662 3'-O-Acetyl-dATP [CAS 28120-63-0]
- QM-0054521-01 Methoxycarbonyl Cefadroxil-d6 [CAS 1246819-89-5]
Other industry favorites
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0053863 L- (+) -Ampicillin-d5
- QM-0053811 L-Glutathione reduced-d5 (ammonium)
- QM-0053172 Methacryloyl-CoA [CAS 6008-91-9]
- QM-0053171 3-Hydroxy-2-methylbutyryl-CoA [CAS 6701-38-8]
- QM-0054252 Acetyl-L-carnitine (hydrochloride) -13C3
- QM-0054203-01 MDMB-FUBINACA metabolite M1 [CAS 2693397-47-4]
- QM-0053343-01 2-Bromoamphetamine (hydrochloride) [CAS 861006-36-2]
- QM-0053309-01 3-Oxohexadecanoyl-CoA [CAS 34619-89-1]
Tubulin cofactor A, Human (Tag Free)
Tubulin cofactor A, Human (Tag Free) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.