Skip to product information
1 of 1

TWEAK/TNFSF12, Rat (HEK293, Fc)

TWEAK/TNFSF12, Rat (HEK293, Fc)

Size

SKU:QM-0169228-01

£137.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis[1]. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs) [2]. TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1[3]. TWEAK protein is a type II transmembrane protein (M1-H249) with a transmembrane domain. TWEAK/TNFSF12 Protein, Rat (HEK293, Fc) is produced by HEK293 cells (R105-H249) with N-terminal rFc-tag.

  • Molecular Formula

    360548 (Gene_ID) Q6AYC1 (R105-H249) (Accession)

  • Smiles

    RAIAAHYEVHPQPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

  • Purity

    96.2

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169228-01
5 µgQM-0169228-01
£137.50/ea
£0.00
£137.50/ea £0.00
10 µgQM-0169228-02
10 µgQM-0169228-02
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0169228-03
50 µgQM-0169228-03
£647.78/ea
£0.00
£647.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TWEAK/TNFSF12, Rat (HEK293, Fc)

TWEAK/TNFSF12, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.