Skip to product information
1 of 1

TXNL4A, Human (His)

TXNL4A, Human (His)

Size

SKU:QM-0179030-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex) . It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    10907 (Gene_ID) P83876 (M1-Y142) (Accession)

  • Smiles

    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0179030-01
5 µgQM-0179030-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0179030-02
10 µgQM-0179030-02
£101.50/ea
£0.00
£101.50/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TXNL4A, Human (His)

TXNL4A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.