Skip to product information
1 of 1

TXNL4B, Human (His)

TXNL4B, Human (His)

Size

SKU:QM-0202425-01

£87.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TXNL4B Protein, vital for pre-mRNA splicing, is crucial for S/G (2) cell cycle transition, forming homodimers and interacting with the U5-102 kDa spliceosome subunit. It plays a key role in splicing intricacies and influences cell cycle dynamics. TXNL4B Protein, Human (His) is the recombinant human-derived TXNL4B protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    54957 (Gene_ID) Q9NX01 (M1-I149) (Accession)

  • Smiles

    MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

  • Purity

    96.7

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202425-01
5 µgQM-0202425-01
£87.26/ea
£0.00
£87.26/ea £0.00
10 µgQM-0202425-02
10 µgQM-0202425-02
£122.00/ea
£0.00
£122.00/ea £0.00
50 µgQM-0202425-03
50 µgQM-0202425-03
£296.13/ea
£0.00
£296.13/ea £0.00
100 µgQM-0202425-04
100 µgQM-0202425-04
£451.65/ea
£0.00
£451.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TXNL4B, Human (His)

TXNL4B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.