Skip to product information
1 of 1

UBASH3A, Human (His)

UBASH3A, Human (His)

Size

SKU:QM-0203885-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    53347 (Gene_ID) P57075-2 (A354-N623) (Accession)

  • Smiles

    ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203885-01
5 µgQM-0203885-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203885-02
10 µgQM-0203885-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203885-03
50 µgQM-0203885-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203885-04
100 µgQM-0203885-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBASH3A, Human (His)

UBASH3A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.