Skip to product information
1 of 1

UBASH3B/STS1, Human (His)

UBASH3B/STS1, Human (His)

Size

SKU:QM-0202586-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UBASH3B/STS1 protein blocks CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activating receptors such as T cell receptors and EGFR on the cell surface. It exhibits tyrosine phosphatase activity against substrates such as EGFR, FAK, SYK and ZAP70. UBASH3B/STS1 Protein, Human (His) is the recombinant human-derived UBASH3B/STS1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    84959 (Gene_ID) Q8TF42 (Q382-E649) (Accession)

  • Smiles

    QKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202586-01
5 µgQM-0202586-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0202586-02
10 µgQM-0202586-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0202586-03
50 µgQM-0202586-03
£331.88/ea
£0.00
£331.88/ea £0.00
100 µgQM-0202586-04
100 µgQM-0202586-04
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBASH3B/STS1, Human (His)

UBASH3B/STS1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.