Skip to product information
1 of 1

UBE2D1, Human (GST)

UBE2D1, Human (GST)

Size

SKU:QM-0192092-01

£105.89 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The UBE2D1 protein is critical in cellular processes. It accepts ubiquitin from the E1 complex and preferentially catalyzes "Lys-48"-linked polyubiquitination in vitro, demonstrating multifunctionality. It mediates the selective degradation of short-lived and aberrant proteins and is involved in E6/E6-AP-induced ubiquitination of p53/TP53. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    7321 (Gene_ID) P51668 (M1-M147) (Accession)

  • Smiles

    MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192092-01
10 µgQM-0192092-01
£105.89/ea
£0.00
£105.89/ea £0.00
50 µgQM-0192092-02
50 µgQM-0192092-02
£152.38/ea
£0.00
£152.38/ea £0.00
100 µgQM-0192092-03
100 µgQM-0192092-03
£252.39/ea
£0.00
£252.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2D1, Human (GST)

UBE2D1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.