Skip to product information
1 of 1

UBE2D4, Human (GST)

UBE2D4, Human (GST)

Size

SKU:QM-0167710-01

£77.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The UBE2D4 protein is an important ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 exhibits multifunctionality by promoting polyubiquitination of all seven ubiquitin Lys residues, possibly favoring polyubiquitination of “Lys-11” and “Lys-48” linkages. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    51619 (Gene_ID) Q9Y2X8 (M1-M147) (Accession)

  • Smiles

    MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0167710-01
10 µgQM-0167710-01
£77.94/ea
£0.00
£77.94/ea £0.00
50 µgQM-0167710-02
50 µgQM-0167710-02
£124.25/ea
£0.00
£124.25/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2D4, Human (GST)

UBE2D4, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.