Skip to product information
1 of 1

UBE2F, Human (His, Solution)

UBE2F, Human (His, Solution)

Size

SKU:QM-0076892-01

£83.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2F Protein, Human (His, Solution) is the recombinant human-derived UBE2F, expressed by E. coli, with N-6*His labeled tag.

  • Molecular Formula

    140739 (Gene_ID) Q969M7-1 (M1-R185) (Accession)

  • Smiles

    MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0076892-01
5 µgQM-0076892-01
£83.12/ea
£0.00
£83.12/ea £0.00
10 µgQM-0076892-02
10 µgQM-0076892-02
£97.61/ea
£0.00
£97.61/ea £0.00
50 µgQM-0076892-03
50 µgQM-0076892-03
£230.52/ea
£0.00
£230.52/ea £0.00
100 µgQM-0076892-04
100 µgQM-0076892-04
£341.08/ea
£0.00
£341.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2F, Human (His, Solution)

UBE2F, Human (His, Solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.