Skip to product information
1 of 1

UBE2G1, Human

UBE2G1, Human

Size

SKU:QM-0200134-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    7326 (Gene_ID) P62253 (M1-E170) (Accession)

  • Smiles

    MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200134-01
5 µgQM-0200134-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0200134-02
10 µgQM-0200134-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0200134-03
50 µgQM-0200134-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2G1, Human

UBE2G1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.