Skip to product information
1 of 1

UBE2G2, Human (GST)

UBE2G2, Human (GST)

Size

SKU:QM-0177997-01

£83.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    7327 (Gene_ID) P60604 (M1-L165) (Accession)

  • Smiles

    MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

  • Purity

    97.5

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0177997-01
10 µgQM-0177997-01
£83.12/ea
£0.00
£83.12/ea £0.00
50 µgQM-0177997-02
50 µgQM-0177997-02
£142.25/ea
£0.00
£142.25/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2G2, Human (GST)

UBE2G2, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.