Skip to product information
1 of 1

UBE2M, Human

UBE2M, Human

Size

SKU:QM-0200790-01

£87.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli , with tag free.

  • Molecular Formula

    9040 (Gene_ID) P61081 (M1-K183) (Accession)

  • Smiles

    MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0200790-01
10 µgQM-0200790-01
£87.26/ea
£0.00
£87.26/ea £0.00
50 µgQM-0200790-02
50 µgQM-0200790-02
£142.25/ea
£0.00
£142.25/ea £0.00
100 µgQM-0200790-03
100 µgQM-0200790-03
£241.46/ea
£0.00
£241.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2M, Human

UBE2M, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.