Skip to product information
1 of 1

UBE2R2, Human (His)

UBE2R2, Human (His)

Size

SKU:QM-0167801

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    54926 (Gene_ID) Q712K3 (M1-S238) (Accession)

  • Smiles

    MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0167801
1 EachQM-0167801
£0.00/ea
£0.00
£0.00/ea £0.00

UBE2R2, Human (His)

UBE2R2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.