UBE2R2, Human (His)
UBE2R2, Human (His)
SKU:QM-0167801
Request quote or documents

Product Details
-
Description
The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
54926 (Gene_ID) Q712K3 (M1-S238) (Accession)
-
Smiles
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
UBE2R2, Human (His)
UBE2R2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.