Skip to product information
1 of 1

UBE2S, Human (GST)

UBE2S, Human (GST)

Size

SKU:QM-0102318

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

  • Molecular Formula

    27338 (Gene_ID) Q16763 (M1-L222) (Accession)

  • Smiles

    MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0102318
1 EachQM-0102318
£0.00/ea
£0.00
£0.00/ea £0.00

UBE2S, Human (GST)

UBE2S, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.