UBE2S, Human (GST)
UBE2S, Human (GST)
SKU:QM-0102318
Request quote or documents

Product Details
-
Description
The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.
-
Molecular Formula
27338 (Gene_ID) Q16763 (M1-L222) (Accession)
-
Smiles
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
UBE2S, Human (GST)
UBE2S, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.