Skip to product information
1 of 1

UBE2T, Human (His)

UBE2T, Human (His)

Size

SKU:QM-0180988-01

£77.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    29089 (Gene_ID) Q9NPD8 (M1-V197) (Accession)

  • Smiles

    MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

  • Purity

    95.02

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180988-01
10 µgQM-0180988-01
£77.94/ea
£0.00
£77.94/ea £0.00
50 µgQM-0180988-02
50 µgQM-0180988-02
£124.25/ea
£0.00
£124.25/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2T, Human (His)

UBE2T, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.