UBE2V1, Human (His)
UBE2V1, Human (His)
SKU:QM-0095188
Request quote or documents

Product Details
-
Description
The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UBE2V1 Protein, Human (His) is the recombinant human-derived UBE2V1 protein, expressed by E. coli , with C-6*His labeled tag.
-
Molecular Formula
7335 (Gene_ID) Q13404 (A2-N147) (Accession)
-
Smiles
AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
UBE2V1, Human (His)
UBE2V1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.