Skip to product information
1 of 1

UBE2V1, Human (His)

UBE2V1, Human (His)

Size

SKU:QM-0095188

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UBE2V1 Protein, Human (His) is the recombinant human-derived UBE2V1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    7335 (Gene_ID) Q13404 (A2-N147) (Accession)

  • Smiles

    AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0095188
1 EachQM-0095188
£0.00/ea
£0.00
£0.00/ea £0.00

UBE2V1, Human (His)

UBE2V1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.