Skip to product information
1 of 1

UBE2V2, Human (sf9, His, strep)

UBE2V2, Human (sf9, His, strep)

Size

SKU:QM-0026147

Price on request
Quantity

Request quote or documents

View full details
  • Description

    UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9, His, strep) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with N-His and N-Strep labeled tag.

  • Molecular Formula

    7336 (Gene_ID) Q15819 (M1-N145) (Accession)

  • Smiles

    MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026147
1 EachQM-0026147
£0.00/ea
£0.00
£0.00/ea £0.00

UBE2V2, Human (sf9, His, strep)

UBE2V2, Human (sf9, His, strep) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.