Skip to product information
1 of 1

UBE2W, Human (His)

UBE2W, Human (His)

Size

SKU:QM-0180995-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    55284 (Gene_ID) Q96B02-1 (M1-C151) (Accession)

  • Smiles

    MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0180995-01
5 µgQM-0180995-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0180995-02
10 µgQM-0180995-02
£97.00/ea
£0.00
£97.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UBE2W, Human (His)

UBE2W, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.