Skip to product information
1 of 1

UCHL3, Mouse (His, solution)

UCHL3, Mouse (His, solution)

Size

SKU:QM-0201360-01

£106.93 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    50933 (Gene_ID) Q9JKB1 (E2-A230) (Accession)

  • Smiles

    EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

  • Purity

    97

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201360-01
5 µgQM-0201360-01
£106.93/ea
£0.00
£106.93/ea £0.00
10 µgQM-0201360-02
10 µgQM-0201360-02
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0201360-03
50 µgQM-0201360-03
£401.83/ea
£0.00
£401.83/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UCHL3, Mouse (His, solution)

UCHL3, Mouse (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.