Skip to product information
1 of 1

UGRP1, Human

UGRP1, Human

Size

SKU:QM-0194051-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    117156 (Gene_ID) Q96PL1 (F22-V93) (Accession)

  • Smiles

    FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0194051-01
10 µgQM-0194051-01
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0194051-02
50 µgQM-0194051-02
£448.52/ea
£0.00
£448.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

UGRP1, Human

UGRP1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.