1 1

ULBP1/RAET1I, Human (Biotinylated, HEK293, mFc-Avi)

ULBP1/RAET1I, Human (Biotinylated, HEK293, mFc-Avi)

Size

QM-0099442-01

£359.82 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

  • Molecular Formula

    80329 (Gene_ID) Q9BZM6 (G26-G216) (Accession)

  • Smiles

    GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0099442-01
20 µgQM-0099442-01
£359.82/ea		 £0.00
£359.82/ea £0.00
50 µgQM-0099442-02
50 µgQM-0099442-02
£630.77/ea		 £0.00
£630.77/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

ULBP1/RAET1I, Human (Biotinylated, HEK293, mFc-Avi)

ULBP1/RAET1I, Human (Biotinylated, HEK293, mFc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.