UPP1, Human (His)

Name: UPP1, Human (His)
Brand: QuantiMol
SKU: QM-0186758-01
Price: 172.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0186758-01

£172.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
UPP1 protein is a key member of the PNP/UDP phosphorylase family and plays an important role in cellular processes, especially nucleotide metabolism. UPP1 shares conserved features with related proteins and is involved in phosphorylase activity. UPP1 Protein, Human (His) is the recombinant human-derived UPP1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
7378 (Gene_ID) Q86Y75 (M1-A173) (Accession)
Smiles
MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0186758-01	10 µgQM-0186758-01 £172.63/ea	£0.00	Quantity	£172.63/ea	£0.00

50 µgQM-0186758-02	50 µgQM-0186758-02 £473.52/ea	£0.00	Quantity	£473.52/ea	£0.00

100 µgQM-0186758-03	100 µgQM-0186758-03 £712.88/ea	£0.00	Quantity	£712.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

UPP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.