Skip to product information
1 of 1

Urocortin III, mouse (TFA)

Urocortin III, mouse (TFA)

Size

SKU:QM-0189588-01

£678.15 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF) -related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].

  • Molecular Formula

    C186H312N52O52S2.xC2HF3O2

  • Smiles

    [FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2(TFAsalt)]

  • Target

    CRFR

  • Purity

    95.93

  • Solubility

    H2O : 25 mg/mL (ultrasonic)

  • Storage Conditions

    -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

  • Shipping Conditions

    Blue Ice

Your cart
Variant Variant total Quantity Price Variant total
5 mgQM-0189588-01
5 mgQM-0189588-01
£678.15/ea
£0.00
£678.15/ea £0.00
10 mgQM-0189588-02
10 mgQM-0189588-02
£1,116.77/ea
£0.00
£1,116.77/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Urocortin III, mouse (TFA)

Urocortin III, mouse (TFA) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.