Skip to product information
1 of 1

VEGF-D, Rat (HEK293, Fc)

VEGF-D, Rat (HEK293, Fc)

Size

SKU:QM-0205500-01

£59.16 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    VEGF-D, a growth factor, stimulates proliferation, migration, and vessel permeability. It is crucial for vascular development and maintenance of lymphatic endothelium. VEGF-D binds and activates VEGFR-3, initiating essential signaling pathways. Structurally, it forms a non-covalent homodimer, playing an intricate role in vascular processes. VEGF-D Protein, Rat (HEK293, Fc) is the recombinant rat-derived VEGF-D protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    360457 (Gene_ID) O35251 (F94-R210) (Accession)

  • Smiles

    FAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205500-01
2 µgQM-0205500-01
£59.16/ea
£0.00
£59.16/ea £0.00
10 µgQM-0205500-02
10 µgQM-0205500-02
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0205500-03
50 µgQM-0205500-03
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0205500-04
100 µgQM-0205500-04
£580.96/ea
£0.00
£580.96/ea £0.00
500 µgQM-0205500-05
500 µgQM-0205500-05
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
1 mgQM-0205500-06
1 mgQM-0205500-06
£2,042.60/ea
£0.00
£2,042.60/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

VEGF-D, Rat (HEK293, Fc)

VEGF-D, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.