VEGF121, Human (120 a.a)

Name: VEGF121, Human (120 a.a)
Brand: QuantiMol
SKU: QM-0204292-01
Price: 77.78 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204292-01

£77.78 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.
Molecular Formula
7422 (Gene_ID) P15692-9 (P28-R147) (Accession)
Smiles
PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204292-01	2 µgQM-0204292-01 £77.78/ea	£0.00	Quantity	£77.78/ea	£0.00

10 µgQM-0204292-02	10 µgQM-0204292-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0204292-03	50 µgQM-0204292-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0204292-04	100 µgQM-0204292-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

VEGF121, Human (120 a.a) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.