VEGF164, Canine (HEK293)

Name: VEGF164, Canine (HEK293)
Brand: QuantiMol
SKU: QM-0179824-01
Price: 271.13 GBP
Availability: InStock

Size 10 µg 20 µg 50 µg 100 µg

SKU:QM-0179824-01

£271.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.
Molecular Formula
403802 (Gene_ID) Q9MYV3-3/NP_001103972.1 (A27-R190) (Accession)
Smiles
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0179824-01	10 µgQM-0179824-01 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

20 µgQM-0179824-02	20 µgQM-0179824-02 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

50 µgQM-0179824-03	50 µgQM-0179824-03 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

100 µgQM-0179824-04	100 µgQM-0179824-04 £1,046.30/ea	£0.00	Quantity	£1,046.30/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

VEGF164, Canine (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.