VEGF164, Rat (CHO)

Name: VEGF164, Rat (CHO)
Brand: QuantiMol
SKU: QM-0194874-01
Price: 122.88 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0194874-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.
Molecular Formula
83785 (Gene_ID) P16612-2 (A27-R190) (Accession)
Smiles
APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0194874-01	2 µgQM-0194874-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

10 µgQM-0194874-02	10 µgQM-0194874-02 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

50 µgQM-0194874-03	50 µgQM-0194874-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

VEGF164, Rat (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.