VISTA/B7-H5, Mouse (159a.a, HEK293, His)

Name: VISTA/B7-H5, Mouse (159a.a, HEK293, His)
Brand: QuantiMol
SKU: QM-0178703-01
Price: 217.67 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0178703-01

£217.67 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
VISTA/B7-H5 Protein is a type I transmembrane protein expressed primarily in white blood cells that inhibits T cell function. VISTA/B7-H5 Protein promotes embryonic stem cell differentiation by inhibiting BMP4 signaling and stimulates MMP14 mediated MMP2 activation. VISTA/B7-H5 Protein is highly expressed in tumors. VISTA/B7-H5 Protein, Mouse (159a.a, HEK293, His) is the recombinant mouse-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
74048 (Gene_ID) Q9D659 (F33-A191) (Accession)
Smiles
FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0178703-01	10 µgQM-0178703-01 £217.67/ea	£0.00	Quantity	£217.67/ea	£0.00

50 µgQM-0178703-02	50 µgQM-0178703-02 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

VISTA/B7-H5, Mouse (159a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.