Name: VISTA/B7-H5, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205565-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
VISTA/B7-H5 protein, an immunoregulatory receptor, inhibits T-cell response and may regulate embryonic stem cell differentiation by inhibiting BMP4 signaling. It also stimulates MMP14-mediated MMP2 activation, suggesting a role in matrix metalloproteinase processes. These roles highlight the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics. VISTA/B7-H5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
690899 (Gene_ID) G3V9P3 (I33-A191) (Accession)
Smiles
IKVTTPYSLYVCPEGQNVTLTCRILDSVSKGHDANFLKTWFLSSRGEVQVCKEHRPIRNFISHHQHHRSHPAVNASHDQPQKHGLEIAYDNHGNFSITLHNVTLSDSGLYCCLVIEVKHHHPERRLYGYMELQVQTGKGSASTCTAYPPNEQDSDSITA
Purity
95.9
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205565-01	5 µgQM-0205565-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205565-02	10 µgQM-0205565-02 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

50 µgQM-0205565-03	50 µgQM-0205565-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

100 µgQM-0205565-04	100 µgQM-0205565-04 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

500 µgQM-0205565-05	500 µgQM-0205565-05 £857.98/ea	£0.00	Quantity	£857.98/ea	£0.00

1 mgQM-0205565-06	1 mgQM-0205565-06 £1,422.95/ea	£0.00	Quantity	£1,422.95/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

VISTA/B7-H5, Rat (HEK293, Fc)

VISTA/B7-H5, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.