Skip to product information
1 of 1

VNN2/Vanin-2, Human (HEK293, His)

VNN2/Vanin-2, Human (HEK293, His)

Size

SKU:QM-0135931

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    VNN2/Vanin-2 Proteinas, an amidohydrolase, crucially hydrolyzes D-pantetheine's carboamide linkage, recycling pantothenic acid and releasing cysteamine. Apart from its vitamin metabolism role, VNN2 is involved in thymus homing of bone marrow cells and may regulate beta-2 integrin-mediated processes, influencing neutrophil adhesion, migration, and motility. VNN2/Vanin-2 Protein, Human (HEK293, His) is the recombinant human-derived VNN2/Vanin-2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    8875 (Gene_ID) O95498-1 (Q23-S492) (Accession)

  • Smiles

    QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0135931
10 µgQM-0135931
£117.25/ea
£0.00
£117.25/ea £0.00

VNN2/Vanin-2, Human (HEK293, His)

VNN2/Vanin-2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.