Skip to product information
1 of 1

VSIG8, Human (HEK293, Fc)

VSIG8, Human (HEK293, Fc)

Size

SKU:QM-0103207

Price on request
Quantity

Request quote or documents

View full details
  • Description

    V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of nave T cells. VSIG8 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    391123 (Gene_ID) P0DPA2 (V22-G263) (Accession)

  • Smiles

    VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0103207
1 EachQM-0103207
£0.00/ea
£0.00
£0.00/ea £0.00

VSIG8, Human (HEK293, Fc)

VSIG8, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.