VSIG8, Human (HEK293, Fc)
VSIG8, Human (HEK293, Fc)
SKU:QM-0103207
Request quote or documents

Product Details
-
Description
V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of nave T cells. VSIG8 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
391123 (Gene_ID) P0DPA2 (V22-G263) (Accession)
-
Smiles
VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
VSIG8, Human (HEK293, Fc)
VSIG8, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.