Skip to product information
1 of 1

VSNL1, Human (His)

VSNL1, Human (His)

Size

SKU:QM-0202991-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human (His) is the recombinant human-derived VSNL1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    7447 (Gene_ID) P62760 (M1-K191) (Accession)

  • Smiles

    MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202991-01
5 µgQM-0202991-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0202991-02
10 µgQM-0202991-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0202991-03
50 µgQM-0202991-03
£426.65/ea
£0.00
£426.65/ea £0.00
100 µgQM-0202991-04
100 µgQM-0202991-04
£702.46/ea
£0.00
£702.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

VSNL1, Human (His)

VSNL1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.