WBP1, Human (His)
WBP1, Human (His)
SKU:QM-0168321
Request quote or documents

Product Details
-
Description
WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.
-
Molecular Formula
23559 (Gene_ID) Q96G27 (G170-P269) (Accession)
-
Smiles
GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
WBP1, Human (His)
WBP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.