Skip to product information
1 of 1

WBP1, Human (His)

WBP1, Human (His)

Size

SKU:QM-0168321

Price on request
Quantity

Request quote or documents

View full details
  • Description

    WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    23559 (Gene_ID) Q96G27 (G170-P269) (Accession)

  • Smiles

    GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0168321
1 EachQM-0168321
£0.00/ea
£0.00
£0.00/ea £0.00

WBP1, Human (His)

WBP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.