Skip to product information
1 of 1

Wee1, Human (sf9, His)

Wee1, Human (sf9, His)

Size

SKU:QM-0195547-01

£429.78 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

  • Molecular Formula

    7465 (Gene_ID) P30291 (M291-K575) (Accession)

  • Smiles

    MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0195547-01
10 µgQM-0195547-01
£429.78/ea
£0.00
£429.78/ea £0.00
50 µgQM-0195547-02
50 µgQM-0195547-02
£1,071.30/ea
£0.00
£1,071.30/ea £0.00
100 µgQM-0195547-03
100 µgQM-0195547-03
£1,669.08/ea
£0.00
£1,669.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Wee1, Human (sf9, His)

Wee1, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.