WIBG, Human (His)
WIBG, Human (His)
SKU:QM-0114857
Request quote or documents

Product Details
-
Description
WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.
-
Molecular Formula
84305 (Gene_ID) Q9BRP8 (M1-L204) (Accession)
-
Smiles
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
WIBG, Human (His)
WIBG, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.