Skip to product information
1 of 1

WIBG, Human (His)

WIBG, Human (His)

Size

SKU:QM-0114857

Price on request
Quantity

Request quote or documents

View full details
  • Description

    WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    84305 (Gene_ID) Q9BRP8 (M1-L204) (Accession)

  • Smiles

    MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0114857
1 EachQM-0114857
£0.00/ea
£0.00
£0.00/ea £0.00

WIBG, Human (His)

WIBG, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.