Name: WIF-1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0205986-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway. In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development. WIF-1 Protein, Human (HEK293, His) is the recombinant human-derived WIF-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
11197 (Gene_ID) AAH18037.1 (G29-W379) (Accession)
Smiles
GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW
Purity
97.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205986-01	5 µgQM-0205986-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0205986-02	10 µgQM-0205986-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205986-03	50 µgQM-0205986-03 £277.21/ea	£0.00	Quantity	£277.21/ea	£0.00

100 µgQM-0205986-04	100 µgQM-0205986-04 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

250 µgQM-0205986-05	250 µgQM-0205986-05 £825.17/ea	£0.00	Quantity	£825.17/ea	£0.00

500 µgQM-0205986-06	500 µgQM-0205986-06 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

1 mgQM-0205986-07	1 mgQM-0205986-07 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

WIF-1, Human (HEK293, His)

WIF-1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.