Skip to product information
1 of 1

WIF-1, Mouse (HEK293, His)

WIF-1, Mouse (HEK293, His)

Size

SKU:QM-0166017

£437.58 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway.In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development.WIF-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived WIF-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    24117 (Gene_ID) Q9WUA1 (M1-W379) (Accession)

  • Smiles

    MARRRAFPAFALRLWSILPCLLLLRADAGQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW

  • Purity

    95.5

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0166017
50 µgQM-0166017
£437.58/ea
£0.00
£437.58/ea £0.00

WIF-1, Mouse (HEK293, His)

WIF-1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.