XCL1, Rat (His)

Name: XCL1, Rat (His)
Brand: QuantiMol
SKU: QM-0203706-01
Price: 104.88 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203706-01

£104.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
171371 (Gene_ID) P51672 (V22-G114) (Accession)
Smiles
VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203706-01	2 µgQM-0203706-01 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

10 µgQM-0203706-02	10 µgQM-0203706-02 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

50 µgQM-0203706-03	50 µgQM-0203706-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

100 µgQM-0203706-04	100 µgQM-0203706-04 £1,212.76/ea	£0.00	Quantity	£1,212.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

XCL1, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.