YebF, E.coli (Myc, His)
YebF, E.coli (Myc, His)
SKU:QM-0096228
Request quote or documents

Product Details
-
Description
YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.
-
Molecular Formula
946363 (Gene_ID) P33219 (A22-R118) (Accession)
-
Smiles
ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
YebF, E.coli (Myc, His)
YebF, E.coli (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.