Skip to product information
1 of 1

YebF, E.coli (Myc, His)

YebF, E.coli (Myc, His)

Size

SKU:QM-0096228

Price on request
Quantity

Request quote or documents

View full details
  • Description

    YebF protein, existing as a monomer in solution, interacts with OmpF/OmpC at the periplasmic face of the membrane, indicating a role in bacterial membrane-related processes. Its monomeric state emphasizes independent structure, prompting further investigation into the molecular mechanisms and functional impact of its interactions with OmpF/OmpC in the bacterial membrane. YebF Protein, E.coli (Myc, His) is the recombinant E. coli-derived YebF protein, expressed by E. coli , with N-His, C-Myc labeled tag.

  • Molecular Formula

    946363 (Gene_ID) P33219 (A22-R118) (Accession)

  • Smiles

    ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0096228
1 EachQM-0096228
£0.00/ea
£0.00
£0.00/ea £0.00

YebF, E.coli (Myc, His)

YebF, E.coli (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.