YTHDF2, Human (His)

Name: YTHDF2, Human (His)
Brand: QuantiMol
SKU: QM-0195759-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 20 µg 50 µg 100 µg

SKU:QM-0195759-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag.
Molecular Formula
51441 (Gene_ID) Q9Y5A9 (S2-K579) (Accession)
Smiles
SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0195759-01	10 µgQM-0195759-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

20 µgQM-0195759-02	20 µgQM-0195759-02 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

50 µgQM-0195759-03	50 µgQM-0195759-03 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

100 µgQM-0195759-04	100 µgQM-0195759-04 £691.52/ea	£0.00	Quantity	£691.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

YTHDF2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.