Name: ZG16B, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0206028-01
Price: 72.61 GBP
Availability: InStock

Product Details

Description
Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag.
Molecular Formula
124220 (Gene_ID) Q96DA0 (G17-R172) (Accession)
Smiles
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0206028-01	5 µgQM-0206028-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0206028-02	10 µgQM-0206028-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

20 µgQM-0206028-03	20 µgQM-0206028-03 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0206028-04	50 µgQM-0206028-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0206028-05	100 µgQM-0206028-05 £470.39/ea	£0.00	Quantity	£470.39/ea	£0.00

250 µgQM-0206028-06	250 µgQM-0206028-06 £935.74/ea	£0.00	Quantity	£935.74/ea	£0.00

500 µgQM-0206028-07	500 µgQM-0206028-07 £1,644.08/ea	£0.00	Quantity	£1,644.08/ea	£0.00

1 mgQM-0206028-08	1 mgQM-0206028-08 £2,817.77/ea	£0.00	Quantity	£2,817.77/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ZG16B, Human (HEK293, His)

ZG16B, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.