Skip to product information
1 of 1

AKT1, Human (S473D, sf9, His, GST)

AKT1, Human (S473D, sf9, His, GST)

Size

SKU:QM-0026153

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The AKT1 protein is part of the AKT kinase family and is critical for metabolism, proliferation, survival, growth, and angiogenesis. It phosphorylates more than 100 substrates, coordinates insulin-induced SLC2A4/GLUT4 translocation, affects glucose uptake, and controls glycogen storage through inhibition of GSK3A/B. AKT1 Protein, Human (S473D, sf9, His, GST) is the recombinant human-derived AKT1 protein, expressed by Sf9 insect cells, with N-His and N-GST labeled tag.

  • Molecular Formula

    207 (Gene_ID) P31749 (M118-A480, S473D) (Accession)

  • Smiles

    MDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFDYSASGTA

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026153
1 EachQM-0026153
£0.00/ea
£0.00
£0.00/ea £0.00

AKT1, Human (S473D, sf9, His, GST)

AKT1, Human (S473D, sf9, His, GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.