BAFFR/TNFRSF13C, Human (HEK293, His)
BAFFR/TNFRSF13C, Human (HEK293, His)
SKU:QM-0128560-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation[1]. BAFFR/TNFRSF13C Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, produced in HEK293 cells.
-
Molecular Formula
115650 (Gene_ID) Q96RJ3-1 (S7-A71) (Accession)
-
Smiles
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0054477-01 Zoledronic acid-15N2,13C2 [CAS 1189694-79-8]
- QM-0054003 δ-Hexachlorocyclohexane-13C6
- QM-0050094-01 Zopiclone impurity-1 [CAS 43200-81-3]
- QM-0026012 β-CL, Ala (13C3,15N) (TFA)
- QM-0025750-01 β-Amyloid (1-42), human, Ala (13C3,15N) (TFA)
- QM-0025699 YLYEIA- (Arg-13C6,15N4) (TFA)
- QM-0021653 β-Carotene-13C10 [CAS 301150-50-5]
- QM-0021627 β-Alanine-13C [CAS 65138-34-3]
- QM-0017969 Zonisamide-13C6
Other industry favorites
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0054477-01 Zoledronic acid-15N2,13C2 [CAS 1189694-79-8]
- QM-0149176-01 β-lactosyl-13C
- QM-0162836-01 Xylose-2-13C [CAS 131771-69-2]
- QM-0081032 Zinc Protoporphyrin-d2,15N2
- QM-0096503 Zileuton-13C2,15N
- QM-0002345-01 γ-Glu- (Phe-13C9,15N) (TFA)
- QM-0162837-01 Xylose-5-13C [CAS 139657-63-9]
- QM-0060991 Yohimbine-13C, d3 [CAS 1261254-59-4]
- QM-0074149 β-D-Glucose pentaacetate-13C6 [CAS 213020-65-6]
BAFFR/TNFRSF13C, Human (HEK293, His)
BAFFR/TNFRSF13C, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.