BMP-2, Zebrafish
BMP-2, Zebrafish
SKU:QM-0178950-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
Bone morphogenetic protein 2 (BMP-2) is a pleiotropic ligand protein belonging to TGFβ family, and is involved in key embryonic development of vascular and valvular homeostasis. BMP-2 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to regulate various types of calcification, including atherosclerosis, chronic kidney disease, diabetes, and valve calcification[1]. BMP-2 is overexpressed by myofibroblast and preosteoblast in the calcified area of human calcified valve, which are densely infiltrated by B lymphocytes and T lymphocytes[5]. BMP-2 is the junction between atherosclerotic vascular calcification and normal bone formation mechanism[6]. Zebrafish BMP-2 Protein has a length of 386 a.a., BMP-2 Protein, Zebrafish is 105 a.a. (Q272-R386), expressed in E. coli cells with tag free.
-
Molecular Formula
/ (Gene_ID) B3DI86 (Q272-R386) (Accession)
-
Smiles
QARNNKQRKKHKANCRRHSLYVDFSDVGWNDWIVAPPGYHAFYCQGECPFPLADHLNSTNHAIVQTLVNSVNSNIPRACCVPTDLSPVSLLYLDEYERVILKNYQDMVVEGCGCR
-
Purity
97.2
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0008932 VEGFR-IN-7 [CAS 683235-33-8]
- QM-0008931 VEGFR-IN-6 [CAS 683235-34-9]
- QM-0008885 VEGFR/PDGFR-IN-1 [CAS 342785-98-2]
- QM-0008364-01 Verubecestat (Standard) [CAS 1286770-55-5]
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
- QM-0002017 Zabadinostat (Standard) [CAS 934828-12-3]
- QM-0079654-01 Zabadinostat [CAS 934828-12-3]
Other industry favorites
- QM-0015916 Wee1/HDAC-IN-1 [CAS 3037071-29-4]
- QM-0013795-01 Vizenpistat [CAS 2687222-58-6]
- QM-0154836-01 Verdiperstat [CAS 890655-80-8]
- QM-0142135-01 Virstatin [CAS 88909-96-0]
- QM-0081849-01 Vorinostat (Standard) [CAS 149647-78-9]
- QM-0070505 VEGFR2-IN-3 [CAS 417717-09-0]
- QM-0081529-01 Ziritaxestat [CAS 1628260-79-6]
- QM-0205620-01 VEGFR-3/FLT4, Mouse (HEK293, hFc)
- QM-0178627-01 VinylMyristate (stabilizedwithMEHQ) [CAS 5809-91-6]
- QM-0175073-01 [Nle8] Somatostatin (1-28) (TFA)
BMP-2, Zebrafish
BMP-2, Zebrafish is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.